Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIA2 Rabbit Polyclonal Antibody (HRP)

GRIA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GLUR2, GLURB, GluA2, HBGR2, NEDLIB, gluR-2, gluR-B, GluR-K2

UniProt

P42262

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GRIA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSR

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC

NCBI Accession Number

NP_000817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

12 Cell Culture Inserts+12 Well Plate, 5.0 μm, PC Membrane, Translucent, Non-Treated, Sterile, 12/pk, 48/cs
CS0005-724211 1 Each

12 Cell Culture Inserts+12 Well Plate, 5.0 μm, PC Membrane, Translucent, Non-Treated, Sterile, 12/pk, 48/cs

Sign In for Pricing
View Details
Human Heparanase (HPA) ELISA Kit
YP-W17310-01 48 Tests

Human Heparanase (HPA) ELISA Kit

Sign In for Pricing
View Details
Human Heparanase (HPA) ELISA Kit
YP-W17310-02 96 Tests

Human Heparanase (HPA) ELISA Kit

Sign In for Pricing
View Details
Lentiviral human DNAJB12 shRNA (UAS) - Lentiviral human DNAJB12 shRNA (UAS, GFP) plasmid
GTR15099886 1 Vial

Lentiviral human DNAJB12 shRNA (UAS) - Lentiviral human DNAJB12 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
PDE4 (PDE4B) (NM_001037339) Human Over-expression Lysate
LH19897V 100 µg

PDE4 (PDE4B) (NM_001037339) Human Over-expression Lysate

Sign In for Pricing
View Details
Lentiviral mouse Wnt2b shRNA (UAS) - Lentiviral mouse Wnt2b shRNA (UAS, iRFP) (100)
GTR15226503 1 Vial

Lentiviral mouse Wnt2b shRNA (UAS) - Lentiviral mouse Wnt2b shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details