Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRIA2 Rabbit Polyclonal Antibody (HRP)

GRIA2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GLUR2, GLURB, GluA2, HBGR2, NEDLIB, gluR-2, gluR-B, GluR-K2

UniProt

P42262

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GRIA2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANSFAVTNAFCSQFSR

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

99kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC

NCBI Accession Number

NP_000817

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Beclin-1 (Beclin 1 (Coiled-coil Moesin-like BCL2-interacting Protein), Beclin1, BECN1, APG6, ATG6, ATG6 Autophagy-related 6 Homolog, Coiled-coil Myosin-like Bcl-2-Interacting Protein, GT197, Protein GT197, VPS30) (MaxLight 550)
B0981-23U-ML550 100 µL

Beclin-1 (Beclin 1 (Coiled-coil Moesin-like BCL2-interacting Protein), Beclin1, BECN1, APG6, ATG6, ATG6 Autophagy-related 6 Homolog, Coiled-coil Myosin-like Bcl-2-Interacting Protein, GT197, Protein GT197, VPS30) (MaxLight 550)

Sign In for Pricing
View Details
MAPK9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
28076111 3x 1.0 µg

MAPK9 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Scp2d1 Mouse shRNA Lentiviral Particle (Locus ID 66328)
TL514341V 500 µL Each

Scp2d1 Mouse shRNA Lentiviral Particle (Locus ID 66328)

Sign In for Pricing
View Details
Rabbit Polyclonal PRTFDC1 Antibody [Alexa Fluor 647]
NBP3-00245AF647 0.1 mL

Rabbit Polyclonal PRTFDC1 Antibody [Alexa Fluor 647]

Sign In for Pricing
View Details
Goat Tumor necrosis factor receptor superfamily member 16 (NGFR) ELISA kit
GTR10392686 96 Well

Goat Tumor necrosis factor receptor superfamily member 16 (NGFR) ELISA kit

Sign In for Pricing
View Details
HUS1B Polyclonal Antibody
MBS2555439-01 0.06 mL

HUS1B Polyclonal Antibody

Sign In for Pricing
View Details