Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTR1F Rabbit Polyclonal Antibody (FITC)

HTR1F Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

5HT6, MR77, 5-HT1F, HTR1EL, 5-HT-1F

UniProt

P30939

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HTR1F

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIV

Field of Research

Signal Transduction

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000857

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DsdX Antibody
orb813656 2 mg

DsdX Antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli O6 3-deoxy-D-manno-octulosonate 8-phosphate phosphatas KdsC (kdsC)
MBS1254697-01 0.02 mg (E-Coli)

Recombinant Escherichia coli O6 3-deoxy-D-manno-octulosonate 8-phosphate phosphatas KdsC (kdsC)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6 3-deoxy-D-manno-octulosonate 8-phosphate phosphatas KdsC (kdsC)
MBS1254697-02 0.1 mg (E-Coli)

Recombinant Escherichia coli O6 3-deoxy-D-manno-octulosonate 8-phosphate phosphatas KdsC (kdsC)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6 3-deoxy-D-manno-octulosonate 8-phosphate phosphatas KdsC (kdsC)
MBS1254697-03 0.02 mg (Yeast)

Recombinant Escherichia coli O6 3-deoxy-D-manno-octulosonate 8-phosphate phosphatas KdsC (kdsC)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6 3-deoxy-D-manno-octulosonate 8-phosphate phosphatas KdsC (kdsC)
MBS1254697-04 0.1 mg (Yeast)

Recombinant Escherichia coli O6 3-deoxy-D-manno-octulosonate 8-phosphate phosphatas KdsC (kdsC)

Sign In for Pricing
View Details
Recombinant Escherichia coli O6 3-deoxy-D-manno-octulosonate 8-phosphate phosphatas KdsC (kdsC)
MBS1254697-05 0.02 mg (Baculovirus)

Recombinant Escherichia coli O6 3-deoxy-D-manno-octulosonate 8-phosphate phosphatas KdsC (kdsC)

Sign In for Pricing
View Details