Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB8A Rabbit Polyclonal Antibody (Biotin)

RAB8A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MEL, RAB8

UniProt

P61006

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAB8A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005361

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ERAS, NT (F66) (ERAS, HRAS2, HRASP, GTPase ERas, Embryonic stem cell-expressed Ras) (APC)
MBS6296174-01 0.2 mL

ERAS, NT (F66) (ERAS, HRAS2, HRASP, GTPase ERas, Embryonic stem cell-expressed Ras) (APC)

Sign In for Pricing
View Details
ERAS, NT (F66) (ERAS, HRAS2, HRASP, GTPase ERas, Embryonic stem cell-expressed Ras) (APC)
MBS6296174-02 5x 0.2 mL

ERAS, NT (F66) (ERAS, HRAS2, HRASP, GTPase ERas, Embryonic stem cell-expressed Ras) (APC)

Sign In for Pricing
View Details
Prss50 Mouse shRNA Plasmid (Locus ID 235631)
TR507148 1 Kit

Prss50 Mouse shRNA Plasmid (Locus ID 235631)

Sign In for Pricing
View Details
Mouse Modulator of apoptosis 1, MOAP1 ELISA Kit
MBS9337437-01 48 Well

Mouse Modulator of apoptosis 1, MOAP1 ELISA Kit

Sign In for Pricing
View Details
Mouse Modulator of apoptosis 1, MOAP1 ELISA Kit
MBS9337437-02 96 Well

Mouse Modulator of apoptosis 1, MOAP1 ELISA Kit

Sign In for Pricing
View Details
Mouse Modulator of apoptosis 1, MOAP1 ELISA Kit
MBS9337437-03 5x 96 Well

Mouse Modulator of apoptosis 1, MOAP1 ELISA Kit

Sign In for Pricing
View Details