Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB8A Rabbit Polyclonal Antibody (HRP)

RAB8A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MEL, RAB8

UniProt

P61006

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RAB8A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: GIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSNQGVKITP

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_005361

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Empty Tip Boxes
SL-ETB-200 96 Places/Rack, 50 Racks/CTN

Empty Tip Boxes

Sign In for Pricing
View Details
EphA7 Protein Vector (Mouse) (pPM-C-HA)
PV175960 500 ng

EphA7 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
1- (3,4-Dimethoxycinnamoyl) piperidine
orb1684927 1 mg

1- (3,4-Dimethoxycinnamoyl) piperidine

Sign In for Pricing
View Details
SYT7 Protein Vector (Human) (pPM-C-HA)
PV058539 500 ng

SYT7 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Lentiviral mouse Gorasp2 shRNA (UAS) - Lentiviral mouse Gorasp2 shRNA (UAS) plasmid
GTR15136999 1 Vial

Lentiviral mouse Gorasp2 shRNA (UAS) - Lentiviral mouse Gorasp2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
CD19 (CD19 Molecule, B-Lymphocyte Surface Antigen B4, T-Cell Surface Antigen Leu-12, Differentiation Antigen CD19, CD19 Antigen, CVID3, B4) discontinued
376106 500 µg

CD19 (CD19 Molecule, B-Lymphocyte Surface Antigen B4, T-Cell Surface Antigen Leu-12, Differentiation Antigen CD19, CD19 Antigen, CVID3, B4) discontinued

Sign In for Pricing
View Details