Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STX1A Rabbit Polyclonal Antibody (HRP)

STX1A Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

STX1, HPC-1, P35-1, SYN1A

UniProt

Q16623

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human STX1A

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: KDRTQELRTAKDSDDDDDVAVTVDRDRFMDEFFEQVEEIRGFIDKIAENV

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_004594

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS503852 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Tissue FFPE Sections, Colon
CS802402 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI9F3]
CF813260 100 µg

CTLA4 Mouse Monoclonal Antibody [Clone ID: OTI9F3]

Sign In for Pricing
View Details
mLH1 Human Gene Knockout Kit (CRISPR)
KN201607LP 1 Kit

mLH1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 10/13 (DE-K13), CF405S conjugate, 0.1mg/mL
BNC040696-500 1x 500 µL

Cytokeratin 10/13 (DE-K13), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Roxatidine Acetate Hydrochloride
TRC-R700870-1G 1 g

Roxatidine Acetate Hydrochloride

Sign In for Pricing
View Details