Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB14 Rabbit Polyclonal Antibody (HRP)

RAB14 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FBP, RAB-14

UniProt

P61106

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RAB14

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FLEAAKKIYQNIQDGSLDLNAAESGVQHKPSAPQGGRLTSEPQPQREGCG

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

24kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Goat, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_057406

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tube Rack (set of 2 for 24 tubes)
MIX5074 2 / PCK

Tube Rack (set of 2 for 24 tubes)

Sign In for Pricing
View Details
Human ARHGEF9 activation kit by CRISPRa
GA108143 1 Kit

Human ARHGEF9 activation kit by CRISPRa

Sign In for Pricing
View Details
CBL-C, CT (Signal Transduction Protein CBL-C, SH3-binding Protein CBL-C, SH3-binding Protein CBL-3, CBL3, RING Finger Protein 57, RNF57) (AP)
MBS6466250-01 0.2 mL

CBL-C, CT (Signal Transduction Protein CBL-C, SH3-binding Protein CBL-C, SH3-binding Protein CBL-3, CBL3, RING Finger Protein 57, RNF57) (AP)

Sign In for Pricing
View Details
CBL-C, CT (Signal Transduction Protein CBL-C, SH3-binding Protein CBL-C, SH3-binding Protein CBL-3, CBL3, RING Finger Protein 57, RNF57) (AP)
MBS6466250-02 5x 0.2 mL

CBL-C, CT (Signal Transduction Protein CBL-C, SH3-binding Protein CBL-C, SH3-binding Protein CBL-3, CBL3, RING Finger Protein 57, RNF57) (AP)

Sign In for Pricing
View Details
HCM (RNMT) (NM_003799) Human Over-expression Lysate
LY418425 100 µg

HCM (RNMT) (NM_003799) Human Over-expression Lysate

Sign In for Pricing
View Details
Canine Chromosome transmission fidelity protein 8 homolog isoform 2 (CHTF8) ELISA kit
GTR10372126 96 Well

Canine Chromosome transmission fidelity protein 8 homolog isoform 2 (CHTF8) ELISA kit

Sign In for Pricing
View Details