Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNB1 Rabbit Polyclonal Antibody (Biotin)

CTNNB1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EVR7, CTNNB, MRD19, NEDSDV, armadillo

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CTNNB1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: DPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL

Field of Research

Neuroscience

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

XP_001133664

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori® Bovine alpha-Defensin 1 ELISA Kit
GR112246 96 Well

Nori® Bovine alpha-Defensin 1 ELISA Kit

Sign In for Pricing
View Details
1,3-Butanedione,4,4,4-trifluoro-1- (dodecylphenyl) -
68391-65-1 1 Each

1,3-Butanedione,4,4,4-trifluoro-1- (dodecylphenyl) -

Sign In for Pricing
View Details
Recombinant Blochmannia pennsylvanicus Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1293267-01 0.02 mg (E-Coli)

Recombinant Blochmannia pennsylvanicus Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details
Recombinant Blochmannia pennsylvanicus Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1293267-02 0.1 mg (E-Coli)

Recombinant Blochmannia pennsylvanicus Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details
Recombinant Blochmannia pennsylvanicus Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1293267-03 0.02 mg (Baculovirus)

Recombinant Blochmannia pennsylvanicus Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details
Recombinant Blochmannia pennsylvanicus Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)
MBS1293267-04 0.02 mg (Mammalian-Cell)

Recombinant Blochmannia pennsylvanicus Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH)

Sign In for Pricing
View Details