What is the catalog number for CTNNB1 Rabbit Polyclonal Antibody (FITC)?

The catalog number for CTNNB1 Rabbit Polyclonal Antibody (FITC) is orb2080923.

What sizes are available for CTNNB1 Rabbit Polyclonal Antibody (FITC)?

CTNNB1 Rabbit Polyclonal Antibody (FITC) is available in the following size(s): 100 µL.

Is CTNNB1 Rabbit Polyclonal Antibody (FITC) in stock?

CTNNB1 Rabbit Polyclonal Antibody (FITC) is currently made to order / not held in immediate stock. Contact us for lead time.

CTNNB1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EVR7, CTNNB, MRD19, NEDSDV, armadillo

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CTNNB1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL

Field of Research

Neuroscience

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.