Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT14 Rabbit Polyclonal Antibody (HRP)

KRT14 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

K14, NFJ, CK14, EBS3, EBS4

UniProt

P02533

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human KRT14

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Guinea pig, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_000517

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TEM7 Lentiviral Activation Particles (h)
sc-406089-LAC 200 µL

TEM7 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Human Uteroglobin ELISA Kit
MBS824741-01 96 Tests

Human Uteroglobin ELISA Kit

Sign In for Pricing
View Details
Human Uteroglobin ELISA Kit
MBS824741-02 5x 96 Tests

Human Uteroglobin ELISA Kit

Sign In for Pricing
View Details
5-DBCO-PEG4-UTP, S pack
JBS-CLK-055S 20 µL

5-DBCO-PEG4-UTP, S pack

Sign In for Pricing
View Details
CD40 Monoclonal Antibody
TA398736 100 µg

CD40 Monoclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Cxcl2 shRNA (UAS) - Lentiviral mouse Cxcl2 shRNA (UAS) (25)
GTR15201737 1 Vial

Lentiviral mouse Cxcl2 shRNA (UAS) - Lentiviral mouse Cxcl2 shRNA (UAS) (25)

Sign In for Pricing
View Details