Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANOG Rabbit Polyclonal Antibody (Biotin)

NANOG Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q6JZS5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NANOG

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPK

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_079141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ELOVL7 Antibody
A10141 0.1 mg

Anti-ELOVL7 Antibody

Sign In for Pricing
View Details
Vom2r62 (NM_001099509) Rat Tagged ORF Clone Lentiviral Particle
RR213620L3V 200 µL

Vom2r62 (NM_001099509) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Erg-1/2/3 shRNA (m) Lentiviral Particles
sc-35334-V 200 µL

Erg-1/2/3 shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Rho GDP Dissociation Inhibitor Alpha (ARHGDIa)
TRV-0010165-01 10 µg

Recombinant Rho GDP Dissociation Inhibitor Alpha (ARHGDIa)

Sign In for Pricing
View Details
Recombinant Rho GDP Dissociation Inhibitor Alpha (ARHGDIa)
TRV-0010165-02 50 µg

Recombinant Rho GDP Dissociation Inhibitor Alpha (ARHGDIa)

Sign In for Pricing
View Details
Recombinant Rho GDP Dissociation Inhibitor Alpha (ARHGDIa)
TRV-0010165-03 100 µg

Recombinant Rho GDP Dissociation Inhibitor Alpha (ARHGDIa)

Sign In for Pricing
View Details