Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANOG Rabbit Polyclonal Antibody (FITC)

NANOG Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q6JZS5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NANOG

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPK

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_079141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rce1 ORF Vector (Mouse) (pORF)
38745014 1.0 µg DNA

Rce1 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
STAT 6, phosphorylated (STAT6B, STAT6C, D12S1644, IL-4-STAT, interleukin 4 induced STAT, Signal Transducer and Activator of Transcription 6) (MaxLight 750) discontinued
S7972-46-ML750 100 µL

STAT 6, phosphorylated (STAT6B, STAT6C, D12S1644, IL-4-STAT, interleukin 4 induced STAT, Signal Transducer and Activator of Transcription 6) (MaxLight 750) discontinued

Sign In for Pricing
View Details
MTF1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F3]
TA805480AM 100 µL

MTF1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F3]

Sign In for Pricing
View Details
Rat Anti-Mouse CD45R/B220, Antibody
GWB-1A7800 0.1 mg

Rat Anti-Mouse CD45R/B220, Antibody

Sign In for Pricing
View Details
SNX18P10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV786140 1.0 µg DNA

SNX18P10 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
SPTB Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV624902 1.0 µg DNA

SPTB Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details