Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANOG Rabbit Polyclonal Antibody (HRP)

NANOG Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6JZS5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NANOG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPK

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_079141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGPAT1 (1-acyl-sn-glycerol-3-phosphate Acyltransferase alpha, 1-acylglycerol-3-phosphate O-acyltransferase 1, G15, LPAATA, 1-AGPAT1, LPAAT-alpha) (MaxLight 750)
MBS6444950-01 0.1 mL

AGPAT1 (1-acyl-sn-glycerol-3-phosphate Acyltransferase alpha, 1-acylglycerol-3-phosphate O-acyltransferase 1, G15, LPAATA, 1-AGPAT1, LPAAT-alpha) (MaxLight 750)

Sign In for Pricing
View Details
AGPAT1 (1-acyl-sn-glycerol-3-phosphate Acyltransferase alpha, 1-acylglycerol-3-phosphate O-acyltransferase 1, G15, LPAATA, 1-AGPAT1, LPAAT-alpha) (MaxLight 750)
MBS6444950-02 5x 0.1 mL

AGPAT1 (1-acyl-sn-glycerol-3-phosphate Acyltransferase alpha, 1-acylglycerol-3-phosphate O-acyltransferase 1, G15, LPAATA, 1-AGPAT1, LPAAT-alpha) (MaxLight 750)

Sign In for Pricing
View Details
NFkB-p105 (Nuclear Factor NF-kappa-B p105 Subunit, DNA-Binding Factor KBF1, EBP-1, Nuclear Factor of kappa Light, Polypeptide Gene Enhancer in B-Cells 1, NFKB1, NFkB p105) discontinued
224501-01 50 µL

NFkB-p105 (Nuclear Factor NF-kappa-B p105 Subunit, DNA-Binding Factor KBF1, EBP-1, Nuclear Factor of kappa Light, Polypeptide Gene Enhancer in B-Cells 1, NFKB1, NFkB p105) discontinued

Sign In for Pricing
View Details
NFkB-p105 (Nuclear Factor NF-kappa-B p105 Subunit, DNA-Binding Factor KBF1, EBP-1, Nuclear Factor of kappa Light, Polypeptide Gene Enhancer in B-Cells 1, NFKB1, NFkB p105) discontinued
224501-02 100 µL

NFkB-p105 (Nuclear Factor NF-kappa-B p105 Subunit, DNA-Binding Factor KBF1, EBP-1, Nuclear Factor of kappa Light, Polypeptide Gene Enhancer in B-Cells 1, NFKB1, NFkB p105) discontinued

Sign In for Pricing
View Details
Lentiviral mouse E030030I06Rik shRNA (UAS) - Lentiviral mouse E030030I06Rik shRNA (UAS, RFP) (25)
GTR15254291 1 Vial

Lentiviral mouse E030030I06Rik shRNA (UAS) - Lentiviral mouse E030030I06Rik shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Rabbit Polyclonal FAM111B Antibody [DyLight 488]
NBP3-18411G 0.1 mL

Rabbit Polyclonal FAM111B Antibody [DyLight 488]

Sign In for Pricing
View Details