Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NANOG Rabbit Polyclonal Antibody (HRP)

NANOG Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q6JZS5

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NANOG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPK

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

35kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Porcine

Tested Applications

WB

NCBI Accession Number

NP_079141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Chordin (CHRD) ELISA Kit
abx506647 96 Tests

Mouse Chordin (CHRD) ELISA Kit

Sign In for Pricing
View Details
ACSL1 Human qPCR Template Standard (NM_001995)
HK200540 1 Kit

ACSL1 Human qPCR Template Standard (NM_001995)

Sign In for Pricing
View Details
Gm4636 3'UTR Lenti-reporter-Luc Vector
58234084 1.0 µg

Gm4636 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Recombinant Klebsiella Pneumoniae KPK_1978 Protein (aa 1-148)
VAng-Cr4942-50gEcoli 50 µg (E. coli)

Recombinant Klebsiella Pneumoniae KPK_1978 Protein (aa 1-148)

Sign In for Pricing
View Details
STC1, CT (Stanniocalcin-1 [Precursor], STC-1, STC1, STC)
042387 200 µL

STC1, CT (Stanniocalcin-1 [Precursor], STC-1, STC1, STC)

Sign In for Pricing
View Details
Rat Epo/Erythropoietin ELISA Kit
E45K00453 96 Tests

Rat Epo/Erythropoietin ELISA Kit

Sign In for Pricing
View Details