Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNB1 Rabbit Polyclonal Antibody (Biotin)

CTNNB1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

EVR7, CTNNB, MRD19, NEDSDV, armadillo

UniProt

P35222

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human CTNNB1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRV

Field of Research

Neuroscience

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001895

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1, DEAD Box protein 1, DBP-RB, DEAD Box Protein-Retinoblastoma DDX-1, UKVH5d) (AP)
MBS6130893-01 0.1 mL

DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1, DEAD Box protein 1, DBP-RB, DEAD Box Protein-Retinoblastoma DDX-1, UKVH5d) (AP)

Sign In for Pricing
View Details
DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1, DEAD Box protein 1, DBP-RB, DEAD Box Protein-Retinoblastoma DDX-1, UKVH5d) (AP)
MBS6130893-02 5x 0.1 mL

DDX1 (DEAD (Asp-Glu-Ala-Asp) Box Polypeptide 1, DEAD Box protein 1, DBP-RB, DEAD Box Protein-Retinoblastoma DDX-1, UKVH5d) (AP)

Sign In for Pricing
View Details
MRPL21 Rabbit mAb
A26947-01 20 µL

MRPL21 Rabbit mAb

Sign In for Pricing
View Details
MRPL21 Rabbit mAb
A26947-02 100 μL

MRPL21 Rabbit mAb

Sign In for Pricing
View Details
MRPL21 Rabbit mAb
A26947-03 500 μL

MRPL21 Rabbit mAb

Sign In for Pricing
View Details
MRPL21 Rabbit mAb
A26947-04 1000 μL

MRPL21 Rabbit mAb

Sign In for Pricing
View Details