Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNB1 Rabbit Polyclonal Antibody (HRP)

CTNNB1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EVR7, CTNNB, MRD19, NEDSDV, armadillo

UniProt

P35222

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of human CTNNB1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDP

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

85kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Zebrafish

Tested Applications

ChIP, WB

NCBI Accession Number

NP_001895

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

p53, Phosphorylated (Ser315) (Cellular Tumor Antigen p53, Tumor Suppressor p53, Phosphoprotein p53, Antigen NY-CO-13, TP53, P53) (MaxLight 750)
MBS6491447-01 0.1 mL

p53, Phosphorylated (Ser315) (Cellular Tumor Antigen p53, Tumor Suppressor p53, Phosphoprotein p53, Antigen NY-CO-13, TP53, P53) (MaxLight 750)

Sign In for Pricing
View Details
p53, Phosphorylated (Ser315) (Cellular Tumor Antigen p53, Tumor Suppressor p53, Phosphoprotein p53, Antigen NY-CO-13, TP53, P53) (MaxLight 750)
MBS6491447-02 5x 0.1 mL

p53, Phosphorylated (Ser315) (Cellular Tumor Antigen p53, Tumor Suppressor p53, Phosphoprotein p53, Antigen NY-CO-13, TP53, P53) (MaxLight 750)

Sign In for Pricing
View Details
Anti-VPS35 (Recombinant Rabbit, Monoclonal, IgG)
A123158 100 µL

Anti-VPS35 (Recombinant Rabbit, Monoclonal, IgG)

Sign In for Pricing
View Details
3-Hydroxyacyl-CoA dehydratase 1 (PTPLA) Sheep ELISA Kit
B0554 96 Tests

3-Hydroxyacyl-CoA dehydratase 1 (PTPLA) Sheep ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Kif5a shRNA (UAS) - Lentiviral mouse Kif5a shRNA (UAS, RFP) plasmid
GTR15170917 1 Vial

Lentiviral mouse Kif5a shRNA (UAS) - Lentiviral mouse Kif5a shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Influenza B virus Nucleoprotein (NP)
CSB-EP356318IJU(F1)-01 10 µg

Influenza B virus Nucleoprotein (NP)

Sign In for Pricing
View Details