Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETS1 Rabbit Polyclonal Antibody (HRP)

ETS1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P54, ETS-1, EWSR2, c-ets-1

UniProt

P14921

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ETS1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005229

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C20orf29 3'UTR Luciferase Stable Cell Line
TU003193 1.0 mL

C20orf29 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
EMID2 Peptide
DF10102-BP 1 mg

EMID2 Peptide

Sign In for Pricing
View Details
CDR2L Antibody, HRP conjugated
MBS7107804-01 0.05 mg

CDR2L Antibody, HRP conjugated

Sign In for Pricing
View Details
CDR2L Antibody, HRP conjugated
MBS7107804-02 0.1 mg

CDR2L Antibody, HRP conjugated

Sign In for Pricing
View Details
CDR2L Antibody, HRP conjugated
MBS7107804-03 5x 0.1 mg

CDR2L Antibody, HRP conjugated

Sign In for Pricing
View Details
Pribolab® 12 Bits Immunoaffinity Column Operating Rack
HWEQ-RK 5020 1 Unit

Pribolab® 12 Bits Immunoaffinity Column Operating Rack

Sign In for Pricing
View Details