Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETS1 Rabbit Polyclonal Antibody (HRP)

ETS1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P54, ETS-1, EWSR2, c-ets-1

UniProt

P14921

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ETS1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN

Field of Research

Immunology & Inflammation

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_005229

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Sarcolipin,SLN ELISA KIT
JOT-EK1270Ra-01 48 Well

Rat Sarcolipin,SLN ELISA KIT

Sign In for Pricing
View Details
Rat Sarcolipin,SLN ELISA KIT
JOT-EK1270Ra-02 96 Well

Rat Sarcolipin,SLN ELISA KIT

Sign In for Pricing
View Details
UCK2 (Uridine-cytidine Kinase 2, UCK 2, Cytidine Monophosphokinase 2, Testis-specific Protein TSA903, Uridine Monophosphokinase 2, UMPK) (MaxLight 405) discontinued
135050-ML405 100 µL

UCK2 (Uridine-cytidine Kinase 2, UCK 2, Cytidine Monophosphokinase 2, Testis-specific Protein TSA903, Uridine Monophosphokinase 2, UMPK) (MaxLight 405) discontinued

Sign In for Pricing
View Details
GNL2 Rabbit pAb, PerCP-Cy7 conjugated
orb2840938 100 µL

GNL2 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
KLK13 Protein Vector (Rat) (pPM-C-HA)
PV276532 500 ng

KLK13 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
RAB24 (S108) (Ras-related protein Rab-24, RAB24) (AP) discontinued
040744-AP 200 µL

RAB24 (S108) (Ras-related protein Rab-24, RAB24) (AP) discontinued

Sign In for Pricing
View Details