Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JUN Rabbit Polyclonal Antibody (Biotin)

JUN Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AP1, p39, AP-1, cJUN, c-Jun

UniProt

P05412

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human JUN

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP

Field of Research

Cancer Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002219

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Arrestin Beta 1 ELISA Kit
MBS016953-01 48 Well

Mouse Arrestin Beta 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Arrestin Beta 1 ELISA Kit
MBS016953-02 96 Well

Mouse Arrestin Beta 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Arrestin Beta 1 ELISA Kit
MBS016953-03 5x 96 Well

Mouse Arrestin Beta 1 ELISA Kit

Sign In for Pricing
View Details
Mouse Arrestin Beta 1 ELISA Kit
MBS016953-04 10x 96 Well

Mouse Arrestin Beta 1 ELISA Kit

Sign In for Pricing
View Details
Human DEFb2 ELISA Kit
orb439103-01 48 Tests

Human DEFb2 ELISA Kit

Sign In for Pricing
View Details
Human DEFb2 ELISA Kit
orb439103-02 96 Tests

Human DEFb2 ELISA Kit

Sign In for Pricing
View Details