Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JUN Rabbit Polyclonal Antibody (FITC)

JUN Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AP1, p39, AP-1, cJUN, c-Jun

UniProt

P05412

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human JUN

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP

Field of Research

Cancer Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_002219

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNFSF18 Rabbit Polyclonal Antibody (Carrier-free)
orb3105767 100 µg

TNFSF18 Rabbit Polyclonal Antibody (Carrier-free)

Sign In for Pricing
View Details
Ig heavy chain V-III region Light
CRB1000996 25 nmoL

Ig heavy chain V-III region Light

Sign In for Pricing
View Details
Anti-Maxi Potassium channel alpha/KCNMA1 Antibody Picoband® (Dylight594 Conjugate)
PB9227-Dylight594 100 µg

Anti-Maxi Potassium channel alpha/KCNMA1 Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
Runx1t1 3'UTR GFP Stable Cell Line
TU168261 1.0 mL

Runx1t1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Ctf1 Mouse Pre-designed siRNA Set A
HY-RS17741 1 Set

Ctf1 Mouse Pre-designed siRNA Set A

Sign In for Pricing
View Details
ANXA2 (Phospho-Tyr24) Polyclonal Conjugated Antibody
MBS9438299-01 0.1 mL (AF350)

ANXA2 (Phospho-Tyr24) Polyclonal Conjugated Antibody

Sign In for Pricing
View Details