Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ERG Rabbit Polyclonal Antibody (HRP)

ERG Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P55, erg-3

UniProt

P11308

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ERG

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ARNTDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPYQ

Field of Research

Cancer Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004440

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC34 Rabbit Polyclonal Antibody (FITC)
orb2087517 100 µL

CCDC34 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Enpep Rabbit Polyclonal Antibody (FITC)
orb2091267 100 µL

Enpep Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
ERBB2, phosphorylated (S1114) (Erbb2, Kiaa3023, Neu, Receptor tyrosine-protein kinase erbB-2, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, p185erbB2, CD340) (MaxLight 405) discontinued
035169-ML405 100 µL

ERBB2, phosphorylated (S1114) (Erbb2, Kiaa3023, Neu, Receptor tyrosine-protein kinase erbB-2, Proto-oncogene Neu, Proto-oncogene c-ErbB-2, p185erbB2, CD340) (MaxLight 405) discontinued

Sign In for Pricing
View Details
CRIP3 Protein Vector (Mouse) (pPM-C-His)
PV168041 500 ng

CRIP3 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
BDP (ARID3B) Antibody (C-term) Blocking peptide
MBS9221130-01 0.5 mg

BDP (ARID3B) Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details
BDP (ARID3B) Antibody (C-term) Blocking peptide
MBS9221130-02 5x 0.5 mg

BDP (ARID3B) Antibody (C-term) Blocking peptide

Sign In for Pricing
View Details