Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOS Rabbit Polyclonal Antibody (FITC)

FOS Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

P55, AP-1, C-FOS

UniProt

P01100

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FOS

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPKPSVEPVKSISSMELK

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005243

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), Biotin conjugate, 0.1mg/mL
BNCB1950-500 1x 500 µL

Bcl-6 (Follicular Lymphoma Marker) (rBCL6/1527), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caspase-10 Antibody
F42859-0.4ML 0.4 mL

Caspase-10 Antibody

Sign In for Pricing
View Details
Granulin Recombinant Rabbit Monoclonal Antibody [JE37-73]
HA721464 100 µL

Granulin Recombinant Rabbit Monoclonal Antibody [JE37-73]

Sign In for Pricing
View Details
Low Temperature Circulator BCLT-2815
BCLT-2815 Each

Low Temperature Circulator BCLT-2815

Sign In for Pricing
View Details
DCPS Rabbit Polyclonal Antibody
TA361246 100 µL

DCPS Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cytokeratin 18 (KRT18) pSer33 Rabbit Polyclonal Antibody
AP02537PU-S 50 µL

Cytokeratin 18 (KRT18) pSer33 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details