Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAL1 Rabbit Polyclonal Antibody (Biotin)

TAL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SCL, TCL5, tal-1, bHLHa17

UniProt

P17542

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TAL1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QDVLSPNSSCGSSLDGAASPDSYTEEPAPKHTARSLHPAMLPAADGAGPR

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003180

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Angiotensin 1-7 (Ang1-7) ELISA Kit
MBS457586-01 48 Tests

Human Angiotensin 1-7 (Ang1-7) ELISA Kit

Sign In for Pricing
View Details
Human Angiotensin 1-7 (Ang1-7) ELISA Kit
MBS457586-02 96 Tests

Human Angiotensin 1-7 (Ang1-7) ELISA Kit

Sign In for Pricing
View Details
Human Angiotensin 1-7 (Ang1-7) ELISA Kit
MBS457586-03 5x 96 Tests

Human Angiotensin 1-7 (Ang1-7) ELISA Kit

Sign In for Pricing
View Details
Human Angiotensin 1-7 (Ang1-7) ELISA Kit
MBS457586-04 10x 96 Tests

Human Angiotensin 1-7 (Ang1-7) ELISA Kit

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Apolipoprotein B (APOB)
MBS2061903-01 0.1 mL

APC/CY7-Linked Polyclonal Antibody to Apolipoprotein B (APOB)

Sign In for Pricing
View Details
APC/CY7-Linked Polyclonal Antibody to Apolipoprotein B (APOB)
MBS2061903-02 0.2 mL

APC/CY7-Linked Polyclonal Antibody to Apolipoprotein B (APOB)

Sign In for Pricing
View Details