Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEK Rabbit Polyclonal Antibody (Biotin)

DEK Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

D6S231E

UniProt

P35659

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DEK

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEG

Field of Research

Epigenetics & Chromatin

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003463

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL5P22 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV774882 1.0 µg DNA

RPL5P22 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Taar8c sgRNA CRISPR Lentivector (Rat) (Target 1)
K7304802 1.0 µg DNA

Taar8c sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Tissue Factor Pathway Inhibitor (TFPI) Magnetic Fluorescence Assay Kit
MBS2155417-01 96 Tests

Tissue Factor Pathway Inhibitor (TFPI) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Tissue Factor Pathway Inhibitor (TFPI) Magnetic Fluorescence Assay Kit
MBS2155417-02 5x 96 Tests

Tissue Factor Pathway Inhibitor (TFPI) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Tissue Factor Pathway Inhibitor (TFPI) Magnetic Fluorescence Assay Kit
MBS2155417-03 10x 96 Tests

Tissue Factor Pathway Inhibitor (TFPI) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Porcine RegeneRating Islet Derived Protein 4 ELISA Kit
MBS743522-01 48 Well

Porcine RegeneRating Islet Derived Protein 4 ELISA Kit

Sign In for Pricing
View Details