Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOS Rabbit Polyclonal Antibody (Biotin)

FOS Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P55, AP-1, C-FOS

UniProt

P01100

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FOS

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLA

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005243

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(E)-Sacubitril Maleic Acid
TRC-S809385-50MG 50 mg

(E)-Sacubitril Maleic Acid

Sign In for Pricing
View Details
Nkap Mouse shRNA Plasmid (Locus ID 67050)
TR503806 1 Kit

Nkap Mouse shRNA Plasmid (Locus ID 67050)

Sign In for Pricing
View Details
Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 5 (CD40)
TRV-0035677-01 20 µL

Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 5 (CD40)

Sign In for Pricing
View Details
Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 5 (CD40)
TRV-0035677-02 100 µL

Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 5 (CD40)

Sign In for Pricing
View Details
Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 5 (CD40)
TRV-0035677-03 200 µL

Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 5 (CD40)

Sign In for Pricing
View Details
Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 5 (CD40)
TRV-0035677-04 1 mL

Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 5 (CD40)

Sign In for Pricing
View Details