Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOS Rabbit Polyclonal Antibody (Biotin)

FOS Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

P55, AP-1, C-FOS

UniProt

P01100

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human FOS

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CTPSCTAYTSSFVFTYPEADSFPSCAAAHRKGSSSNEPSSDSLSSPTLLA

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_005243

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA2 (Heat shock-related 70kD Protein 2, Heat Shock 70kD Protein 2) (MaxLight 750) discontinued
128128-ML750 100 µL

HSPA2 (Heat shock-related 70kD Protein 2, Heat Shock 70kD Protein 2) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Human Zinc finger protein 101 (ZNF101) ELISA Kit
abx384414 96 Tests

Human Zinc finger protein 101 (ZNF101) ELISA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Receptor Superfamily Member 9 (TNFRSF9) ELISA Kit
MBS9716730-01 48 Tests

Mouse Tumor Necrosis Factor Receptor Superfamily Member 9 (TNFRSF9) ELISA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Receptor Superfamily Member 9 (TNFRSF9) ELISA Kit
MBS9716730-02 96 Tests

Mouse Tumor Necrosis Factor Receptor Superfamily Member 9 (TNFRSF9) ELISA Kit

Sign In for Pricing
View Details
Mouse Tumor Necrosis Factor Receptor Superfamily Member 9 (TNFRSF9) ELISA Kit
MBS9716730-03 5x 96 Tests

Mouse Tumor Necrosis Factor Receptor Superfamily Member 9 (TNFRSF9) ELISA Kit

Sign In for Pricing
View Details
ACE2 siRNA (Human)
orb1856498-01 15 nmol

ACE2 siRNA (Human)

Sign In for Pricing
View Details