Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFX1 Rabbit Polyclonal Antibody (HRP)

NFX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

NFX2, Tex42, TEG-42

UniProt

Q12986

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NFX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TLTGVLEREMQARPPPPIPHHRHQSDKNPGSSNLQKITKEPIIDYFDVQD

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

124kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Rabbit, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_002495

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gonadotropin Releasing Hormone (GnRH) BioAssayTM ELISA Kit (Rat)
517258 96 Tests

Gonadotropin Releasing Hormone (GnRH) BioAssayTM ELISA Kit (Rat)

Sign In for Pricing
View Details
Nori® Human MMP-10 ELISA Kit
GR111240 96 Well

Nori® Human MMP-10 ELISA Kit

Sign In for Pricing
View Details
Lentiviral mouse Arih1 shRNA (UAS) - Lentiviral mouse Arih1 shRNA (UAS, iRFP) plasmid
GTR15237076 1 Vial

Lentiviral mouse Arih1 shRNA (UAS) - Lentiviral mouse Arih1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Nori® Human BMI-1 ELISA Kit
GR111444 96 Well

Nori® Human BMI-1 ELISA Kit

Sign In for Pricing
View Details
L1TD1 Rabbit Polyclonal Antibody (Fluoro647)
orb3094494 100 µg

L1TD1 Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
Bovine Striatin-4 (STRN4) ELISA Kit
MBS9355163-01 48 Well

Bovine Striatin-4 (STRN4) ELISA Kit

Sign In for Pricing
View Details