Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RFX1 Rabbit Polyclonal Antibody (HRP)

RFX1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EFC, RFX

UniProt

P22670

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human RFX1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ESEDELPQDISLAAGGESPALGPETLEPPAKLARTDARGLFVQALPSS

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

105kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002909

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polyclonal Antibody to Acid Phosphatase 5, Tartrate Resistant (ACP5)
TRV-0000379-01 20 µL

Polyclonal Antibody to Acid Phosphatase 5, Tartrate Resistant (ACP5)

Sign In for Pricing
View Details
Polyclonal Antibody to Acid Phosphatase 5, Tartrate Resistant (ACP5)
TRV-0000379-02 100 µL

Polyclonal Antibody to Acid Phosphatase 5, Tartrate Resistant (ACP5)

Sign In for Pricing
View Details
Polyclonal Antibody to Acid Phosphatase 5, Tartrate Resistant (ACP5)
TRV-0000379-03 200 µL

Polyclonal Antibody to Acid Phosphatase 5, Tartrate Resistant (ACP5)

Sign In for Pricing
View Details
Polyclonal Antibody to Acid Phosphatase 5, Tartrate Resistant (ACP5)
TRV-0000379-04 1 mL

Polyclonal Antibody to Acid Phosphatase 5, Tartrate Resistant (ACP5)

Sign In for Pricing
View Details
Human CellExp™ LEFTY-I, Human Recombinant
4873-50 50 µg

Human CellExp™ LEFTY-I, Human Recombinant

Sign In for Pricing
View Details
Anti-HAUS8 Antibody Picoband® Cy3 Conjugated
A12994-2-Cy3 100 µg/Vial

Anti-HAUS8 Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details