Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMRT1 Rabbit Polyclonal Antibody (Biotin)

DMRT1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DMT1, CT154

UniProt

Q9Y5R6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DMRT1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGSS

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_068770

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

GL54D, CT (Glycosyltransferase 54 domain-containing protein,) (Biotin)
MBS6302404-01 0.2 mL

GL54D, CT (Glycosyltransferase 54 domain-containing protein,) (Biotin)

Sign In for Pricing
View Details
GL54D, CT (Glycosyltransferase 54 domain-containing protein,) (Biotin)
MBS6302404-02 5x 0.2 mL

GL54D, CT (Glycosyltransferase 54 domain-containing protein,) (Biotin)

Sign In for Pricing
View Details
HAX1 (NM_006118) Human Tagged Lenti ORF Clone
RC202690L2 10 µg

HAX1 (NM_006118) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Streptavidin Poly-HRP20 Conjugate
65R-S109 0.05 mg

Streptavidin Poly-HRP20 Conjugate

Sign In for Pricing
View Details
Pack of 100 Filter Discs For Sterilization, 90 Mm
FT320A0090C Pack of 100

Pack of 100 Filter Discs For Sterilization, 90 Mm

Sign In for Pricing
View Details
IFluor® 660 Anti-human CD85j Antibody *GHI/75*
108510G0-AAT 100 Tests

IFluor® 660 Anti-human CD85j Antibody *GHI/75*

Sign In for Pricing
View Details