Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DMRT1 Rabbit Polyclonal Antibody (HRP)

DMRT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DMT1, CT154

UniProt

Q9Y5R6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DMRT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGSS

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

39kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Porcine, Rabbit

Tested Applications

WB

NCBI Accession Number

NP_068770

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CD248 shRNA Plasmid
abx961338-01 150 µg

Human CD248 shRNA Plasmid

Sign In for Pricing
View Details
Human CD248 shRNA Plasmid
abx961338-02 300 µg

Human CD248 shRNA Plasmid

Sign In for Pricing
View Details
SHP1 Antibody (Tyr536)
MBS5313719-01 0.1 mg

SHP1 Antibody (Tyr536)

Sign In for Pricing
View Details
SHP1 Antibody (Tyr536)
MBS5313719-02 5x 0.1 mg

SHP1 Antibody (Tyr536)

Sign In for Pricing
View Details
Recombinant Trichomonas vaginalis Probable glucokinase 2 (GK2)
MBS1335217-01 0.02 mg (E-Coli)

Recombinant Trichomonas vaginalis Probable glucokinase 2 (GK2)

Sign In for Pricing
View Details
Recombinant Trichomonas vaginalis Probable glucokinase 2 (GK2)
MBS1335217-02 0.02 mg (Yeast)

Recombinant Trichomonas vaginalis Probable glucokinase 2 (GK2)

Sign In for Pricing
View Details