Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF12 Rabbit Polyclonal Antibody (Biotin)

TCF12 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HEB, p64, CRS3, HTF4, TCF-12, bHLHb20, HsT17266

UniProt

Q99081

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TCF12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDE

Field of Research

Neuroscience

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_996919

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SRP68 (NM_014230) Human Over-expression Lysate
LS006730-100ug 100 µg

SRP68 (NM_014230) Human Over-expression Lysate

Sign In for Pricing
View Details
IL12 A Recombinant Protein C-Fc Tag Lyophilized
MBS8433824-01 0.05 mg

IL12 A Recombinant Protein C-Fc Tag Lyophilized

Sign In for Pricing
View Details
IL12 A Recombinant Protein C-Fc Tag Lyophilized
MBS8433824-02 5x 0.05 mg

IL12 A Recombinant Protein C-Fc Tag Lyophilized

Sign In for Pricing
View Details
Prolactin (LTH, Luteotropic Hormone, Lactogenic Hormone) (MaxLight 490) discontinued
P9009-03P-ML490 100 µL

Prolactin (LTH, Luteotropic Hormone, Lactogenic Hormone) (MaxLight 490) discontinued

Sign In for Pricing
View Details
MPXV-A27L Protein (N-AVI-his, MPXV)
P526858 100 µg

MPXV-A27L Protein (N-AVI-his, MPXV)

Sign In for Pricing
View Details
Caprisil C8-X HPLC Column, 3 µm, 100 Å, CZ535-C8-X x 33 mm
CZ435-C8-X 3 µm

Caprisil C8-X HPLC Column, 3 µm, 100 Å, CZ535-C8-X x 33 mm

Sign In for Pricing
View Details