Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF12 Rabbit Polyclonal Antibody (Biotin)

TCF12 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HEB, p64, CRS3, HTF4, TCF-12, bHLHb20, HsT17266

UniProt

Q99081

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TCF12

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDE

Field of Research

Neuroscience

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_996919

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HTLF Rabbit Polyclonal Antibody (HRP)
orb2129561 100 µL

HTLF Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Lentiviral mouse Nrg2 shRNA (UAS) - Lentiviral mouse Nrg2 shRNA (UAS) plasmid
GTR15212407 1 Vial

Lentiviral mouse Nrg2 shRNA (UAS) - Lentiviral mouse Nrg2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
SDPR Peptide
DF12733-BP 1 mg

SDPR Peptide

Sign In for Pricing
View Details
Crisp4 3'UTR Luciferase Stable Cell Line
TU202799 1.0 mL

Crisp4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
AQP1 Recombinant Rabbit mAb, BF647 conjugated
orb2350576 100 µL

AQP1 Recombinant Rabbit mAb, BF647 conjugated

Sign In for Pricing
View Details
Micro Centrifuge Tubes, PP, 1.5 mL, Sterile DNase/RNase free - 500 un- ABDOS
P10202ST 500 Units/Pack (4x 125 PCS)

Micro Centrifuge Tubes, PP, 1.5 mL, Sterile DNase/RNase free - 500 un- ABDOS

Sign In for Pricing
View Details