Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF12 Rabbit Polyclonal Antibody (HRP)

TCF12 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HEB, p64, CRS3, HTF4, TCF-12, bHLHb20, HsT17266

UniProt

Q99081

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TCF12

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: QQQRMAAIGTDKELSDLLDFSAMFSPPVNSGKTRPTTLGSSQFSGSGIDE

Field of Research

Neuroscience

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

73kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_996919

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ano3 3'UTR GFP Stable Cell Line
TU250681 1.0 mL

Ano3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human AIMP1 Protein, N-His
orb2835453-01 20 µg

Recombinant Human AIMP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human AIMP1 Protein, N-His
orb2835453-02 50 µg

Recombinant Human AIMP1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human AIMP1 Protein, N-His
orb2835453-03 100 µg

Recombinant Human AIMP1 Protein, N-His

Sign In for Pricing
View Details
CHCHD7 Recombinant Protein (Mouse)
RP123836 100 µg

CHCHD7 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Rat Hebp2 Pre-designed siRNA Set B
SI206175B 1 Each

Rat Hebp2 Pre-designed siRNA Set B

Sign In for Pricing
View Details