Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU2F1 Rabbit Polyclonal Antibody (Biotin)

POU2F1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

OCT1, OTF1, Oct1Z, oct-1B

UniProt

P14859

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002688

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apol9b sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3019204 1.0 µg DNA

Apol9b sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
FA43A rabbit pAb
E44H12688 100 µL

FA43A rabbit pAb

Sign In for Pricing
View Details
Lentiviral human ARMCX3 sgRNA gene knockout kit - Lentiviral human ARMCX3 sgRNA gene knockout kit (100)
GTR15400900 1 Vial

Lentiviral human ARMCX3 sgRNA gene knockout kit - Lentiviral human ARMCX3 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Lentiviral mouse Zfp873 shRNA (UAS) - Lentiviral mouse Zfp873 shRNA (UAS, iRFP) (25)
GTR15234554 1 Vial

Lentiviral mouse Zfp873 shRNA (UAS) - Lentiviral mouse Zfp873 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Polyclonal Antibody to Calpain 1, Large Subunit (CAPN1)
MBS2027196-01 0.1 mL

Polyclonal Antibody to Calpain 1, Large Subunit (CAPN1)

Sign In for Pricing
View Details
Polyclonal Antibody to Calpain 1, Large Subunit (CAPN1)
MBS2027196-02 0.2 mL

Polyclonal Antibody to Calpain 1, Large Subunit (CAPN1)

Sign In for Pricing
View Details