Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POU2F1 Rabbit Polyclonal Antibody (FITC)

POU2F1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

OCT1, OTF1, Oct1Z, oct-1B

UniProt

P14859

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AISTAQAQAFLGHLHQVQLAGTSLQAAAQSLNVQSKSNEESGDSQQPSQP

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002688

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GSK 525768A
A3445-100 100 mg

GSK 525768A

Sign In for Pricing
View Details
Prl6a1 ORF Vector (Rat) (pORF)
ORF074053 1.0 µg DNA

Prl6a1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Anti-NAP1L1 Antibody Picoband® Fluoro594 Conjugated
A05100-1-Fluoro594 100 µg/Vial

Anti-NAP1L1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
FBXO21 Rabbit Polyclonal Antibody (FITC)
orb2121078 100 µL

FBXO21 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
FAM57B Rabbit Polyclonal Antibody (BF405)
orb2504138 100 µL

FAM57B Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
Recombinant Human Arf-GAP with dual PH domain-containing protein 1 (ADAP1)
orb3155893-01 20 µg

Recombinant Human Arf-GAP with dual PH domain-containing protein 1 (ADAP1)

Sign In for Pricing
View Details