Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF1A Rabbit Polyclonal Antibody (Biotin)

TAF1A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

SL1, RAFI48, TAFI48, MGC:17061

UniProt

Q15573

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TAF1A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CLSFIQEALLKHQWQQAAEYMYSYFQTLEDSDSYKRQAAPEIIWKLGSEI

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_005672

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BC024063 3'UTR Luciferase Stable Cell Line
TU102582 1.0 mL

BC024063 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Impa2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7205607 1.0 µg DNA

Impa2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Anti-DHODH Antibody Picoband® Fluoro647 Conjugated
PB10056-Fluoro647 100 µg/Vial

Anti-DHODH Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
PHC1 (Polyhomeotic-like Protein 1, hPH1, Early Development Regulatory Protein 1, EDR1, PH1) (HRP)
131236-HRP 100 µL

PHC1 (Polyhomeotic-like Protein 1, hPH1, Early Development Regulatory Protein 1, EDR1, PH1) (HRP)

Sign In for Pricing
View Details
GCP3 Double Nickase Plasmid (m2)
sc-435198-NIC-2 20 µg

GCP3 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
PMF1 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-62760R-BF594 100 µL

PMF1 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details