Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR2C1 Rabbit Polyclonal Antibody (Biotin)

NR2C1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

TR2

UniProt

Q15625

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NR2C1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QEKAYVEFQDYITKTYPDDTYRLSRLLLRLPALRLMNATITEELFFKGLI

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003288

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MutS protein, thermophilic bacteria
HY-E70607 1 Each

MutS protein, thermophilic bacteria

Sign In for Pricing
View Details
PXK Rabbit Polyclonal Antibody (PE-Cy5)
orb949810 100 µL

PXK Rabbit Polyclonal Antibody (PE-Cy5)

Sign In for Pricing
View Details
5 (6) -carbonylated rhodamine 110 NHS ester
HY-D3049 1 Each

5 (6) -carbonylated rhodamine 110 NHS ester

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana DNA repair protein XRCC3 homolog (XRCC3)
MBS1415390-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana DNA repair protein XRCC3 homolog (XRCC3)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana DNA repair protein XRCC3 homolog (XRCC3)
MBS1415390-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana DNA repair protein XRCC3 homolog (XRCC3)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana DNA repair protein XRCC3 homolog (XRCC3)
MBS1415390-03 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana DNA repair protein XRCC3 homolog (XRCC3)

Sign In for Pricing
View Details