Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NR2C1 Rabbit Polyclonal Antibody (HRP)

NR2C1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TR2

UniProt

Q15625

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NR2C1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ELFTLGLAQCWQVMNVATILATFVNCLHNSLQQDKMSTERRKLLMEHIFK

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003288

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmed9 (BC004691) Mouse Recombinant Protein
E45M48219M5 20 µg

Tmed9 (BC004691) Mouse Recombinant Protein

Sign In for Pricing
View Details
NT Blocking Peptide
MBS9624416-01 1 mg

NT Blocking Peptide

Sign In for Pricing
View Details
NT Blocking Peptide
MBS9624416-02 5x 1 mg

NT Blocking Peptide

Sign In for Pricing
View Details
ANKS1B (Ankyrin Repeat and Sterile alpha Motif Domain-containing Protein 1B, Amyloid-beta Protein Intracellular Domain-associated Protein 1, AIDA-1, E2A-PBX1-associated Protein, EB-1, ANKS1B)
406098-01 50 µL

ANKS1B (Ankyrin Repeat and Sterile alpha Motif Domain-containing Protein 1B, Amyloid-beta Protein Intracellular Domain-associated Protein 1, AIDA-1, E2A-PBX1-associated Protein, EB-1, ANKS1B)

Sign In for Pricing
View Details
ANKS1B (Ankyrin Repeat and Sterile alpha Motif Domain-containing Protein 1B, Amyloid-beta Protein Intracellular Domain-associated Protein 1, AIDA-1, E2A-PBX1-associated Protein, EB-1, ANKS1B)
406098-02 100 µL

ANKS1B (Ankyrin Repeat and Sterile alpha Motif Domain-containing Protein 1B, Amyloid-beta Protein Intracellular Domain-associated Protein 1, AIDA-1, E2A-PBX1-associated Protein, EB-1, ANKS1B)

Sign In for Pricing
View Details
COX8a shRNA (h) Lentiviral Particles
sc-97058-V 200 µL

COX8a shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details