Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATF7 Rabbit Polyclonal Antibody (HRP)

ATF7 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ATFA

UniProt

B2RMP1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ATF7

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ASSFEHEFKKAADEDEKKAAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPD

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_006847

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Oxo-6-phenyl-1,2,3,6-tetrahydro-pyrimidine-4-carboxylic acid
sc-308546 500 mg

2-Oxo-6-phenyl-1,2,3,6-tetrahydro-pyrimidine-4-carboxylic acid

Sign In for Pricing
View Details
Mouse S100 Calcium Binding Protein A8 CLIA Kit
MBS8426471-01 1 Kit

Mouse S100 Calcium Binding Protein A8 CLIA Kit

Sign In for Pricing
View Details
Mouse S100 Calcium Binding Protein A8 CLIA Kit
MBS8426471-02 5x 1 Kit

Mouse S100 Calcium Binding Protein A8 CLIA Kit

Sign In for Pricing
View Details
PF4 Antibody [L7F2]
C20726-50uL 50 μL

PF4 Antibody [L7F2]

Sign In for Pricing
View Details
Flrt2 (NM_001106750) Rat Tagged Lenti ORF Clone
RR215371L4 10 µg

Flrt2 (NM_001106750) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Human Urotensin 2 Receptor (UTS2R) ELISA Kit
DLR-UTS2R-Hu-01 48 Tests

Human Urotensin 2 Receptor (UTS2R) ELISA Kit

Sign In for Pricing
View Details