Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GCM1 Rabbit Polyclonal Antibody (HRP)

GCM1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GCMA, hGCMa

UniProt

Q9NP62

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GCM1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MEPDDFDSEDKEILSWDINDVKLPQNVKKTDWFQEWPDSYAKHIYSSEDK

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_003634

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYLD Human qPCR Template Standard (NM_001042355)
HK208804 1 Kit

CYLD Human qPCR Template Standard (NM_001042355)

Sign In for Pricing
View Details
Recombinant Human PRSS22 Protein, C-His
EHP28301 100 μg

Recombinant Human PRSS22 Protein, C-His

Sign In for Pricing
View Details
Guinea-pig LEP (Leptin) ValidElisa Kit
EK347832 96 Well

Guinea-pig LEP (Leptin) ValidElisa Kit

Sign In for Pricing
View Details
XRCC1, ID (XRCC1, DNA repair protein XRCC1, X-ray repair cross-complementing protein 1) (FITC)
MBS6364053-01 0.2 mL

XRCC1, ID (XRCC1, DNA repair protein XRCC1, X-ray repair cross-complementing protein 1) (FITC)

Sign In for Pricing
View Details
XRCC1, ID (XRCC1, DNA repair protein XRCC1, X-ray repair cross-complementing protein 1) (FITC)
MBS6364053-02 5x 0.2 mL

XRCC1, ID (XRCC1, DNA repair protein XRCC1, X-ray repair cross-complementing protein 1) (FITC)

Sign In for Pricing
View Details
Tumor Necrosis Factor Ligand Superfamily, Member 13 (TNFSF13) BioAssayTM ELISA Kit (Mouse)
028689 96 Tests

Tumor Necrosis Factor Ligand Superfamily, Member 13 (TNFSF13) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details