Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEF2C Rabbit Polyclonal Antibody (Biotin)

MEF2C Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DEL5q14.3, C5DELq14.3

UniProt

Q06413

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MEF2C

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PPSALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRY

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002388

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gdf5-set siRNA/shRNA/RNAi Lentivector (Mouse)
21419094 4x 500 ng

Gdf5-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Recombinant Psychromonas ingrahamii 60 kDa chaperonin 3 (groL3), partial
MBS1198418 Inquire

Recombinant Psychromonas ingrahamii 60 kDa chaperonin 3 (groL3), partial

Sign In for Pricing
View Details
BBS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV705100 1.0 µg DNA

BBS1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
6-Carboxy Tariquidar MTSEA
TRC-C182550-100MG 100 mg

6-Carboxy Tariquidar MTSEA

Sign In for Pricing
View Details
CEP72 (NM_018140) Human Over-expression Lysate
LC413293 20 µg

CEP72 (NM_018140) Human Over-expression Lysate

Sign In for Pricing
View Details
ZNF395 Human Over-expression Lysate
orb1369978 20 µg

ZNF395 Human Over-expression Lysate

Sign In for Pricing
View Details