Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MEF2C Rabbit Polyclonal Antibody (HRP)

MEF2C Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DEL5q14.3, C5DELq14.3

UniProt

Q06413

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MEF2C

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PPSALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRY

Field of Research

Cell Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

51kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002388

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Endo G-L1 Polyclonal Antibody
RA24556-01 50 µL

Endo G-L1 Polyclonal Antibody

Sign In for Pricing
View Details
Endo G-L1 Polyclonal Antibody
RA24556-02 100 µL

Endo G-L1 Polyclonal Antibody

Sign In for Pricing
View Details
GTSE1 Rabbit pAb
orb2713395-01 50 µL

GTSE1 Rabbit pAb

Sign In for Pricing
View Details
GTSE1 Rabbit pAb
orb2713395-02 100 µL

GTSE1 Rabbit pAb

Sign In for Pricing
View Details
Human C14orf132 Knockout A549 cell line
GTR15407424 1 Vial

Human C14orf132 Knockout A549 cell line

Sign In for Pricing
View Details
Mouse Monoclonal beta Tubulin Antibody (4E4) [DyLight 488]
NBP2-50047G 0.1 mL

Mouse Monoclonal beta Tubulin Antibody (4E4) [DyLight 488]

Sign In for Pricing
View Details