Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PAX2 Rabbit Polyclonal Antibody (HRP)

PAX2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

FSGS7, PAPRS

UniProt

Q02962

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PAX2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_000269

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRINL1B CRISPR All-in-one AAV vector set (with saCas9)(Human)
58389151 3x 1.0 µg DNA

GRINL1B CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Anti-CELSR2 Rabbit pAb
GB112930-100 100 μL

Anti-CELSR2 Rabbit pAb

Sign In for Pricing
View Details
FST (Follistatin, FS) (HRP)
246360-HRP 100 µL

FST (Follistatin, FS) (HRP)

Sign In for Pricing
View Details
ADAMTS4 (A Disintegrin And Metalloproteinase with Thrombospondin Motifs 4, ADMP-1, ADAMTS-2, ADAMTS-4) discontinued
209390-01 20 µL

ADAMTS4 (A Disintegrin And Metalloproteinase with Thrombospondin Motifs 4, ADMP-1, ADAMTS-2, ADAMTS-4) discontinued

Sign In for Pricing
View Details
ADAMTS4 (A Disintegrin And Metalloproteinase with Thrombospondin Motifs 4, ADMP-1, ADAMTS-2, ADAMTS-4) discontinued
209390-02 100 µL

ADAMTS4 (A Disintegrin And Metalloproteinase with Thrombospondin Motifs 4, ADMP-1, ADAMTS-2, ADAMTS-4) discontinued

Sign In for Pricing
View Details
Sheep Ragulator Complex Protein LAMTOR1 (C11ORF59) ELISA Kit
OM620878 96 Strip Well

Sheep Ragulator Complex Protein LAMTOR1 (C11ORF59) ELISA Kit

Sign In for Pricing
View Details