Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RUNX1 Rabbit Polyclonal Antibody (Biotin)

RUNX1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AML1, CBFA2, EVI-1, AMLCR1, PEBP2aB, CBF2alpha, AML1-EVI-1, PEBP2alpha

UniProt

B2RMS4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human RUNX1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY

Field of Research

Cancer Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

52kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001745

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 6 Receptor, gp80, endotoxin-free (CD126, IL-6R) (MaxLight 405) discontinued
I8428-39D-ML405 100 µL

Interleukin 6 Receptor, gp80, endotoxin-free (CD126, IL-6R) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Nanog Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2552560 100 µL

Nanog Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Mouse Plppr5 Pre-designed siRNA Set B
SI110770B 1 Each

Mouse Plppr5 Pre-designed siRNA Set B

Sign In for Pricing
View Details
CACNA1I (Voltage-dependent T-type Calcium Channel Subunit alpha-1I, Voltage-gated Calcium Channel Subunit alpha Cav3.3, Ca (v) 3.3, KIAA1120)
124206 100 µg

CACNA1I (Voltage-dependent T-type Calcium Channel Subunit alpha-1I, Voltage-gated Calcium Channel Subunit alpha Cav3.3, Ca (v) 3.3, KIAA1120)

Sign In for Pricing
View Details
Nori® Canine Ephrin B3 ELISA Kit
GR115334 96 Well

Nori® Canine Ephrin B3 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human KIAA0513 Protein, His, E.coli-1mg
QP12485-1mg 1mg

Recombinant Human KIAA0513 Protein, His, E.coli-1mg

Sign In for Pricing
View Details