Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFAP2A Rabbit Polyclonal Antibody (Biotin)

TFAP2A Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AP-2, BOFS, AP2TF, TFAP2, AP-2alpha

UniProt

P05549

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TFAP2A

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NLISHGFGSPAVCAAVTALQNYLTEALKAMDKMYLSNNPNSHTDNNAKSS

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

48kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003211

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Dictyostelium discoideum Aquaporin C (wacA)
MBS7033563-01 0.02 mg

Recombinant Dictyostelium discoideum Aquaporin C (wacA)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Aquaporin C (wacA)
MBS7033563-02 0.1 mg

Recombinant Dictyostelium discoideum Aquaporin C (wacA)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum Aquaporin C (wacA)
MBS7033563-03 5x 0.1 mg

Recombinant Dictyostelium discoideum Aquaporin C (wacA)

Sign In for Pricing
View Details
CHFR (E3 Ubiquitin-protein Ligase CHFR, Checkpoint with Forkhead and RING Finger Domains Protein, RING Finger Protein 196, RNF196, FLJ10796, FLJ33629)
124937 100 µg

CHFR (E3 Ubiquitin-protein Ligase CHFR, Checkpoint with Forkhead and RING Finger Domains Protein, RING Finger Protein 196, RNF196, FLJ10796, FLJ33629)

Sign In for Pricing
View Details
(RS) -MCPG disodium salt
256528-01 10 mg

(RS) -MCPG disodium salt

Sign In for Pricing
View Details
(RS) -MCPG disodium salt
256528-02 50 mg

(RS) -MCPG disodium salt

Sign In for Pricing
View Details