Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFDP1 Rabbit Polyclonal Antibody (HRP)

TFDP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DP1, DILC, Dp-1, DRTF1

UniProt

Q14186

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TFDP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009042

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P Glycoprotein (ABCB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5E3]
TA801010AM 100 µL

P Glycoprotein (ABCB1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5E3]

Sign In for Pricing
View Details
Tissue Genomic DNA, Breast
CD565003 5 µg

Tissue Genomic DNA, Breast

Sign In for Pricing
View Details
LIPJ (Center) Rabbit Polyclonal Antibody
AP52496PU-N 400 µL

LIPJ (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Saa1 (NM_009117) Mouse Tagged ORF Clone
MG200611 10 µg

Saa1 (NM_009117) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
BET1P1 (NM_001162367) Human Over-expression Lysate
LY431123 100 µg

BET1P1 (NM_001162367) Human Over-expression Lysate

Sign In for Pricing
View Details
Beta Catenin Antibody
KC-6323-01 50 μL

Beta Catenin Antibody

Sign In for Pricing
View Details