Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFDP1 Rabbit Polyclonal Antibody (HRP)

TFDP1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

DP1, DILC, Dp-1, DRTF1

UniProt

Q14186

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TFDP1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSASDLTNGADGMLATSSNGSQYSGSRVETPVSYVGEDDEEDDDFNENDE

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_009042

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPIHBP1 (NM_178172) Human Recombinant Protein
TP761366 50 µg

GPIHBP1 (NM_178172) Human Recombinant Protein

Sign In for Pricing
View Details
GNAS (C-term) Rabbit Polyclonal Antibody
AP51874PU-N 400 µL

GNAS (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human IgG4-Fc protein (His tag)
PDMH100403-01 20 µg

Recombinant Human IgG4-Fc protein (His tag)

Sign In for Pricing
View Details
Recombinant Human IgG4-Fc protein (His tag)
PDMH100403-02 100 µg

Recombinant Human IgG4-Fc protein (His tag)

Sign In for Pricing
View Details
Recombinant Human IgG4-Fc protein (His tag)
PDMH100403-03 500 µg

Recombinant Human IgG4-Fc protein (His tag)

Sign In for Pricing
View Details
Recombinant Human IgG4-Fc protein (His tag)
PDMH100403-04 1 mg

Recombinant Human IgG4-Fc protein (His tag)

Sign In for Pricing
View Details