Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LHX2 Rabbit Polyclonal Antibody (Biotin)

LHX2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

LH2, hLhx2

UniProt

P50458

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LHX2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004780

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RTN4R (Reticulon 4 Receptor) ELISA Kit
ELK5164-01 48 Tests

Human RTN4R (Reticulon 4 Receptor) ELISA Kit

Sign In for Pricing
View Details
Human RTN4R (Reticulon 4 Receptor) ELISA Kit
ELK5164-02 96 Tests

Human RTN4R (Reticulon 4 Receptor) ELISA Kit

Sign In for Pricing
View Details
Human RTN4R (Reticulon 4 Receptor) ELISA Kit
ELK5164-03 5x 96 Tests

Human RTN4R (Reticulon 4 Receptor) ELISA Kit

Sign In for Pricing
View Details
RPL7AP42 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
LV775361 1.0 µg DNA

RPL7AP42 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
SEMA3F Antibody, FITC conjugated
MBS7109194-01 0.05 mg

SEMA3F Antibody, FITC conjugated

Sign In for Pricing
View Details
SEMA3F Antibody, FITC conjugated
MBS7109194-02 0.1 mg

SEMA3F Antibody, FITC conjugated

Sign In for Pricing
View Details