Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LHX2 Rabbit Polyclonal Antibody (FITC)

LHX2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LH2, hLhx2

UniProt

P50458

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LHX2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004780

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dog/Canine Alternative Macrophage Activation-Assodiated Cc ChemokIne 1 ELISA Kit
BG-CAN10281 1 Each

Dog/Canine Alternative Macrophage Activation-Assodiated Cc ChemokIne 1 ELISA Kit

Sign In for Pricing
View Details
Aif1 Antibody, Biotin conjugated
A12224-100UG 100 µg

Aif1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Krt76 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
K6154205 3x 1.0 µg

Krt76 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
Lentiviral human PCDHA4 shRNA (UAS) - Lentiviral human PCDHA4 shRNA (UAS, RFP) plasmid
GTR15315784 1 Vial

Lentiviral human PCDHA4 shRNA (UAS) - Lentiviral human PCDHA4 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Mouse Slc16a5 Pre-designed siRNA Set A
SI113023A 1 Each

Mouse Slc16a5 Pre-designed siRNA Set A

Sign In for Pricing
View Details
PRDM12 Antibody
MBS9600421-01 0.1 mL

PRDM12 Antibody

Sign In for Pricing
View Details