Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LHX2 Rabbit Polyclonal Antibody (FITC)

LHX2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LH2, hLhx2

UniProt

P50458

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human LHX2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: AEHLDRDQPYPSSQKTKRMRTSFKHHQLRTMKSYFAINHNPDAKDLKQLA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

44kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_004780

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C17orf85 sgRNA CRISPR Lentivector (Human) (Target 1)
K0321402 1.0 µg DNA

C17orf85 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Polypeptide GalNac Transferase 7/GALNT7 Recombinant Protein Antigen
NBP2-39021PEP 0.1 mL

Polypeptide GalNac Transferase 7/GALNT7 Recombinant Protein Antigen

Sign In for Pricing
View Details
RGS2 (G0S8) discontinued
513612 100 µg

RGS2 (G0S8) discontinued

Sign In for Pricing
View Details
Prostate Specific Antigen (KLK3) (free) mouse monoclonal antibody, clone 103, HRP
AM09250HR-N 200 µL

Prostate Specific Antigen (KLK3) (free) mouse monoclonal antibody, clone 103, HRP

Sign In for Pricing
View Details
Rslcan-10 shRNA Plasmid (m)
sc-153147-SH 20 µg

Rslcan-10 shRNA Plasmid (m)

Sign In for Pricing
View Details
BAAT (NM_001127610) Human Tagged Lenti ORF Clone
RC225667L4 10 µg

BAAT (NM_001127610) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details